SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013779 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013779
Domain Number 1 Region: 58-533
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-165
Family ALDH-like 0.0000000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013779   Gene: ENSPANG00000013805   Transcript: ENSPANT00000010153
Sequence length 535
Comment pep:known_by_projection chromosome:PapAnu2.0:4:24426682:24459173:1 gene:ENSPANG00000013805 transcript:ENSPANT00000010153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCFWLRSCGARRLGSTFPGCRLHPRAGGLVPAPGPAPGPAQLRGYAGGLPGLSAALLR
TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVSEARAAVRAAYEAFCSWREVSAKER
SSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIY
TPAKDKRALVLKQPVGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL
AELASQAGIPPGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSV
KRVSMELGGLAPFIVFDSANVDQAVAGALASKFRNTGQTCVCSNRFLVQRGIHDAFVKAF
AEAMKKNLHVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATIVTGGKRHHLGKNFF
EPTLLSNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANATDVGLAGYFYSQDPAQIWR
VAEQLAVGMVGVNEGLISSVECPFGGVKHSGLGREGSKYGIDEYLELKYVCYGGL
Download sequence
Identical sequences A0A096NLC1
ENSPANP00000013779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]