SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014113 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014113
Domain Number 1 Region: 31-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.14e-92
Family Carbonic anhydrase 0.0000000000967
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014113   Gene: ENSPANG00000016960   Transcript: ENSPANT00000025834
Sequence length 354
Comment pep:known_by_projection chromosome:PapAnu2.0:7:37523791:37580374:-1 gene:ENSPANG00000016960 transcript:ENSPANT00000025834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSSLHAAAVLLLVILKEQPSSPAPANGSKWTYLGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANEQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGTFN
PSYDKIFSHLQHVKYKGQEAFIPGFNIEELLPEKTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQAYTAAGL
SLGIILSLALAGVLGICIVMAVSIWLFRRKSIKKGDNKGVIYKPAIKEETEAHA
Download sequence
Identical sequences A0A096NMA4
ENSPANP00000014113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]