SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014195 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014195
Domain Number 1 Region: 124-295
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.9e-52
Family NadC C-terminal domain-like 0.000027
Further Details:      
 
Domain Number 2 Region: 19-123
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.1e-25
Family NadC N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014195   Gene: ENSPANG00000016498   Transcript: ENSPANT00000021935
Sequence length 309
Comment pep:novel scaffold:PapAnu2.0:JH684875.1:277121:306144:1 gene:ENSPANG00000016498 transcript:ENSPANT00000021935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQPRRLQVTMDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAVLWAKS
PGVLAGRPFFDAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHSLLLGERVALNTLAR
CSGIASAAAAAVEAARGAGWTGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMV
KDNHVVAAGGVEKAVRAARQAADFALKVEVECSSLQEAVQAAEAGADLVLLDNFKPKELH
PTAAALKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEA
APVPKIHWS
Download sequence
Identical sequences ENSPANP00000014195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]