SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014275 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014275
Domain Number 1 Region: 182-446
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-76
Family Protein kinases, catalytic subunit 0.00000000027
Further Details:      
 
Domain Number 2 Region: 77-213
Classification Level Classification E-value
Superfamily SH2 domain 8.48e-35
Family SH2 domain 0.00000154
Further Details:      
 
Domain Number 3 Region: 13-99
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-17
Family SH3-domain 0.0000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014275   Gene: ENSPANG00000016000   Transcript: ENSPANT00000023234
Sequence length 450
Comment pep:known_by_projection chromosome:PapAnu2.0:7:49293683:49314838:1 gene:ENSPANG00000016000 transcript:ENSPANT00000023234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL
Download sequence
Identical sequences A0A096NMR6 A0A0D9RP44 A0A2J8UDB0 A0A2K5LNH2 A0A2K5Z104 A0A2K6K9Z4 A0A2K6RA36 B2R6Q4 G3R6C9 K7AWV1 P41240
ENSP00000220003 gi|187475373|ref|NP_001120662.1| gi|4758078|ref|NP_004374.1| ENSGGOP00000010878 ENSP00000220003 ENSP00000414764 ENSP00000454906 ENSPANP00000014275 ENSGGOP00000010878 ENSP00000220003 ENSP00000414764 ENSP00000438808 ENSP00000454906 NP_001120662.1.87134 NP_001120662.1.92137 NP_004374.1.87134 NP_004374.1.92137 XP_003811144.1.60992 XP_004056566.1.27298 XP_005254222.1.92137 XP_008014063.1.81039 XP_008961717.1.60992 XP_010374171.1.97406 XP_010374172.1.97406 XP_011823913.1.47321 XP_011946214.1.92194 XP_016782687.1.37143 XP_016877414.1.92137 XP_017730438.1.44346 XP_017730439.1.44346 XP_017730440.1.44346 XP_018866669.1.27298 9606.ENSP00000220003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]