SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014373 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014373
Domain Number 1 Region: 424-766
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.71e-90
Family PDEase 0.00000578
Further Details:      
 
Domain Number 2 Region: 162-265
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.6e-16
Family Heme-binding PAS domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000014373
Domain Number - Region: 34-89
Classification Level Classification E-value
Superfamily CheY-like 0.00692
Family CheY-related 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014373   Gene: ENSPANG00000020640   Transcript: ENSPANT00000010453
Sequence length 770
Comment pep:known_by_projection chromosome:PapAnu2.0:7:59022477:59095175:-1 gene:ENSPANG00000020640 transcript:ENSPANT00000010453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF
LDKHHDIIIIDHRNPRQLDAEALCRRSIRSSKLSENTVIVGVVRRVDREELSIMPFIAAG
FTRRYVENPNIMACYNELLQLEFGEVRSQLKLRACNSVFTALENSEDAIEITSEDRVIQY
ANPAFETTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDN
IQQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKIPECVQSDTHTDNQTGKHKDRRKGS
LDVKAVASRTTEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVL
EILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQTVSSNIITPI
SLDDVPPRIARAMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLR
SWLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVD
HPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQ
GIIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGNGDNKSQGIVLMSMVHGNRVLNKT
WGTVVKCETCRPCPSGILKMWKGLTKVYKYSETDEEKQQDLPVVMPVFDRNTCSIPKSQI
SFIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRSLRPPPE
Download sequence
Identical sequences ENSPANP00000014373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]