SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014476 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014476
Domain Number 1 Region: 14-111
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.83e-30
Family Nucleoplasmin-like core domain 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014476   Gene: ENSPANG00000014251   Transcript: ENSPANT00000002199
Sequence length 251
Comment pep:novel chromosome:PapAnu2.0:7:66549825:66550633:1 gene:ENSPANG00000014251 transcript:ENSPANT00000002199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEELMGMYVDTSPLRPQNYLFGCELKADKDYHLRVDNDENEHQLFLRTVSLGPGAKDELD
IVEAEEGNPIKVTLAALKPTVSLGGFEITPLVILRLKCGSEPVHISGHHLAVVEEDAESQ
DEEEEDVRLLSISGKQSAPGSSSKFPQKKVKRAADKDDGEDKDDDDDDNFDDEETEEKTP
VKKSPKNAQKSNQNGKDSKPSSTPRTKGQEFFIKTPKTPKGPSSVEDIKAKMQANVEKGG
SLPKMEAEFFN
Download sequence
Identical sequences ENSPANP00000014476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]