SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014568 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014568
Domain Number 1 Region: 4-306
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.45e-32
Family YeaZ-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014568   Gene: ENSPANG00000021798   Transcript: ENSPANT00000012437
Sequence length 335
Comment pep:known_by_projection chromosome:PapAnu2.0:7:77092326:77100010:-1 gene:ENSPANG00000021798 transcript:ENSPANT00000012437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVLGFEGSANKIGVGVVRDGKVLANPRRTYVTPPGTGFLPGDTARHHRAVILDLLQEA
LTESGLTSQDIDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLVGVNHCIGHIEMGRLI
TGATSPTVLYVSGGNTQVIAYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNI
EQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDVAHRMLATGECTPEDLCFSLQETVFAM
LVEITERAMAHCGSQEALIVGGVGCNVRLQEMMATMCQERGARLFATDERFCIDNGAMIA
QAGWEMFQAGHRTPLSDSGVTQRYRTDEVEVTWRD
Download sequence
Identical sequences A0A096NNK8 A0A2K5HMX5 A0A2K5LDL9 A0A2K5XY89 A0A2K6CM06 A0A2K6K1L8 A0A2K6RMM0 F7FCR0 G8F5P9
9544.ENSMMUP00000009002 ENSPANP00000014568 ENSMMUP00000009002 ENSMMUP00000009002 NP_001244767.1.72884 XP_005560743.1.63531 XP_010375357.1.97406 XP_011769988.1.29376 XP_011813315.1.43180 XP_011831545.1.47321 XP_011932982.1.92194 XP_017723997.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]