SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014848 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014848
Domain Number 1 Region: 167-364
Classification Level Classification E-value
Superfamily E set domains 8.4e-74
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000478
Further Details:      
 
Domain Number 2 Region: 61-183
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.22e-20
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014848   Gene: ENSPANG00000012106   Transcript: ENSPANT00000020745
Sequence length 391
Comment pep:known_by_projection chromosome:PapAnu2.0:14:117794364:117797653:-1 gene:ENSPANG00000012106 transcript:ENSPANT00000020745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNASRWNVFETLIRVLTESMFKRLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVVVNSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLIQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFILSEVNETDDTKM
Download sequence
Identical sequences A0A096NPB9 A0A2K5XVK0
XP_011820812.1.47321 ENSPANP00000014848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]