SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014884 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014884
Domain Number 1 Region: 384-546,588-757
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.69e-44
Family WD40-repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 724-870
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000777
Family Quinoprotein alcohol dehydrogenase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014884   Gene: ENSPANG00000012313   Transcript: ENSPANT00000019957
Sequence length 897
Comment pep:known_by_projection chromosome:PapAnu2.0:14:11126839:11137136:1 gene:ENSPANG00000012313 transcript:ENSPANT00000019957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGAAGPGEGPAREALQSLSQRLRVQEQEMELVKAALAEALRLLRLQVPPSSLQVSGTPA
PPGDSFAAPPGLPPTCTPSLVSRGTQTETEVEFKTSPGPPGLSNGPPAPQGASEEPSGTQ
SEGGGSSSSGAGSPGPPGILRPLQPPQRADTPRRNSSSSSSPSERPRQKLSRKAISSANL
LVRSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYIPSGIRSLEELP
SGPPPETLCLDWVYYGYRGRDSRSNLFVLRSGEVVYFIACVVVLYRPGGGPGGPGGGGQR
HYRGHTDCVRCLAVHPDGVRVASGQTAGVDKDGKPLQPVVHIWDSETLLKLQEIGLGAFE
RGVGALAFSAADQGAFLCVVDDSNEHMLSVWDCSRGVKLAEIKSTNDSVLAVGFNPRDSS
CIVTSGKSHVHFWNWSGGVGVPGNGTLTRKQGVFGKYKKPKFIPCFVFLPDGDILTGDSE
GNILTWGRSASDSKTPGRGGAKETYGIVAQAHAHEGSIFALCLQRDGTVLSGGGRDRRLV
QWGPGLVALQEAEIPEHFGAVRAIAEGLGSELLVGTTKNALLRGDLAQGFSPVIQGHTDE
LWGLCTHPSQNRFLTCGHDRQLCLWDGESHALAWSIDLKETGLCADFHPSGAVVAVGLNT
GRWLVLDTETREIVSDVIDGNEQLSVVRYSPDGLYLAIGSHDNVIYIYSVSSDGAKSSRF
GRCMGHSSFITHLDWSKDGNFIMSNSGDYEILYWDVAGGCKQLKNRYESRDREWATYTCV
LGFHVYGVWPDGSDGTDINSLCRSHNERVVAVADDFCKVHLFQYPCARAKAPSRMYGGHG
SHVTSVRFTHDDSHLVSLGGKDASIFQWRVLGAGGAGPAPATPSRTPSLSPASSLDV
Download sequence
Identical sequences ENSPANP00000014884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]