SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014980 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014980
Domain Number 1 Region: 478-1007
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.14e-152
Family alpha-mannosidase, C-terminal domain 0.00000000000245
Further Details:      
 
Domain Number 2 Region: 52-387
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.26e-121
Family alpha-mannosidase 0.0000000000432
Further Details:      
 
Domain Number 3 Region: 388-495
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.01e-29
Family alpha-mannosidase, domain 2 0.00000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014980   Gene: ENSPANG00000017977   Transcript: ENSPANT00000005906
Sequence length 1014
Comment pep:novel chromosome:PapAnu2.0:19:11410308:11433480:-1 gene:ENSPANG00000017977 transcript:ENSPANT00000005906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAYARAAGVSARGCLDAAGPWTISRALRPPLPPLCFFLLLLLAVPGARAGGYETCPTVQ
PNMLNVHLVPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRFIYV
EIAFFSRWWHQQTNAMREVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFL
EDTFGSDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVW
RASASLKPPTADLFTGVLPNGYNPPMNLCWDVLCVDQPVVEDPRSPEYNAKELVDYFLNV
ATAQGRHYRTNHIVMTMGSDFQYENANMWFKNLDKLIRLVNAQQQAKGSSVHVLYSTPAC
YLWELNKANLTWYLVKHDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVCNQLEA
LVGLAANVGPYGSGDSAPLNKAMAVLQHHDAVSGTSRQHVADDYARQLAAGWGSCEVLLS
NALARLRGFKDHLTFCRQLNISICPLSQTAARFQVIVYNPLGRKVNWMVRLPVSEGVFVV
KDPNGRTVPSDVVVYPSSDSQAHPPELLFSASLPALGFSTYSVAQVPRWKPQARAPQPIP
RRSWSPALTIENEHIRATFDPDTGLLMEIMNMNQRLLLPVRQTFFWYNASIGDSESDQAS
GAYIFRPNQQKPLPVSRWAQIRLVKTPLVQEVHQNFSAWCSQVVRLYPGQRHLELEWSVG
PIPVGDTWGKEVISRFDTPLETKGRFYTDSNGREILERRRDYRPTWKLNQTEPVAGNYYP
VNTRIYITDGNMQLTVLTDRSQGGSSLRDGSLELMVHRRLLKDDERGVSEPLMENGSGAW
VRGRHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGLRRELP
PSVHLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLV
ANQLREAASRLKWTTNTGPTPHQTPYQLDPANITLEPMEIRTFLASVQWKEVDG
Download sequence
Identical sequences ENSPANP00000014980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]