SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015245 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015245
Domain Number 1 Region: 12-138
Classification Level Classification E-value
Superfamily DNA clamp 6.02e-17
Family DNA polymerase processivity factor 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015245
Domain Number - Region: 170-240
Classification Level Classification E-value
Superfamily DNA clamp 0.0911
Family DNA polymerase processivity factor 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015245   Gene: ENSPANG00000005794   Transcript: ENSPANT00000023206
Sequence length 417
Comment pep:known_by_projection chromosome:PapAnu2.0:11:109654954:109690313:1 gene:ENSPANG00000005794 transcript:ENSPANT00000023206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMLKCVMSGSQVKVFGKAVQALSRISDELWLDPSKKGLALRCVNSSRSAYGCVLFSPV
FFQHYQWSALVKMSENELDTTLNLKCKLGMKSILPIFRCLNSLERNIEKCKIFTRSDKCK
VVIQFFYRHGIKRTHNICFQESQPLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVT
LAVTPLNFCLKSSNEESMDLSNAVYSEMFVGSDEFDFFQIGMDTEITFCFKELKGILTFS
EATHAPISIYFDFPGKPLALSIDDMLVEANFILATLADESSRASSPQSLCLSQKRKRSDL
IKKKAGKNITGQALECISRKAAPRRLYPKETLTNISALENCGSPAMKRANGDVSEVSENS
VSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEEDMNNGSFSIF
Download sequence
Identical sequences A0A2K5NT90 A0A2K5YG28
XP_011853252.1.47321 XP_011887810.1.92194 ENSPANP00000015245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]