SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015447 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015447
Domain Number 1 Region: 21-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.35e-90
Family Carbonic anhydrase 0.000000000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015447   Gene: ENSPANG00000012135   Transcript: ENSPANT00000025708
Sequence length 337
Comment pep:known_by_projection chromosome:PapAnu2.0:1:124022308:124029730:1 gene:ENSPANG00000012135 transcript:ENSPANT00000025708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFSALLLEVIWILAADGGQHWTYEGTHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG
SEHQINSEATVAELHIVHYDSDSYDSLSEAAQRPQGLAVLGILIEVGETKNIAYEHILSH
LHEISHKDQKTSVPPFNLRELLPPQLEQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ
LEKLQGTLFSTEEEPSKLLVQNYRAPQPLNQRMVFASFSQAGSLYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLENRKTVVFTSARATTEA
Download sequence
Identical sequences A0A096NQY2
ENSPANP00000015447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]