SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015457 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015457
Domain Number 1 Region: 474-723
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.57e-58
Family Eukaryotic proteases 0.0000312
Further Details:      
 
Domain Number 2 Region: 381-473
Classification Level Classification E-value
Superfamily Kringle-like 1.01e-33
Family Kringle modules 0.00013
Further Details:      
 
Domain Number 3 Region: 204-286
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-33
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 4 Region: 110-202
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-31
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 5 Region: 294-377
Classification Level Classification E-value
Superfamily Kringle-like 1.52e-30
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 6 Region: 34-121
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.94e-16
Family Hairpin loop containing domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015457   Gene: ENSPANG00000007509   Transcript: ENSPANT00000028830
Sequence length 725
Comment pep:known_by_projection chromosome:PapAnu2.0:2:85619071:85623798:1 gene:ENSPANG00000007509 transcript:ENSPANT00000028830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLWWVTVQPPARRMEWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPW
QEDVADAEECAGRCGPLLDCQAFHYNVSSHGCQLLPWTQHSPHTRLRHSGRCDLFQKKDY
IRTCVMDNGVGYRGTVATTVDGLPCQAWSHKFPNDHRYTPTLRNGLEENFCRNPDGDPGG
PWCYTTNPAVRFQSCGIKSCREAACVWCNGEDYRGAVDRTESGRECQRWDLQHPHQHPFE
PGKFLDQGLDDNYCRNPDGSERPWCYTTDPQLEREFCDLPRCGSEAQRRHEATTVSCFRG
KGEGYRGTANTTTAGVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTL
RPGMRVAFCYQIRRCADDVRPQDCYHGTGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTF
TPEPHAQLEENFCRNPDGDSHGPWCYTMDPGTPFDYCALRRCADDQLPSILDPPDQVQFE
KCGKRVDRLDQRRSKLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFSS
CHMPLMGYEVWLGTLFQNPQHGEPGLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVAL
ICLPPEWYVVPPGTKCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMC
TDGLLAPVGACEGDYGGPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSVFVDWIHK
VMRLA
Download sequence
Identical sequences A0A096NQZ2
ENSPANP00000015457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]