SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015485 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015485
Domain Number 1 Region: 8-217
Classification Level Classification E-value
Superfamily SGNH hydrolase 5.04e-59
Family Acetylhydrolase 0.00000000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015485   Gene: ENSPANG00000015041   Transcript: ENSPANT00000022888
Sequence length 229
Comment pep:known_by_projection chromosome:PapAnu2.0:14:106506683:106523983:1 gene:ENSPANG00000015041 transcript:ENSPANT00000022888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWR
ELFSPLHALNFGIEGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEA
IVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFV
HSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA
Download sequence
Identical sequences A0A2I3MC69
ENSPANP00000015485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]