SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015658 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015658
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily Kringle-like 1.64e-25
Family Kringle modules 0.00088
Further Details:      
 
Domain Number 2 Region: 183-290
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-25
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015658   Gene: ENSPANG00000000469   Transcript: ENSPANT00000007293
Sequence length 455
Comment pep:known_by_projection chromosome:PapAnu2.0:10:69626302:69697062:1 gene:ENSPANG00000000469 transcript:ENSPANT00000007293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDV
SPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFC
RSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLV
GACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASRIHFSFPLFDIRDSADMVELL
DGYTHRVLARFHGRNRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPA
VNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVEGW
TVYGLATLLILTVTAIVAKILLHVTFKSHRVPASGDLRDCHQPGTSGEIWSIFYKPSTSI
SIFKKKLKGQSQQDDRNPLDRLEASLGVSEETRLL
Download sequence
Identical sequences ENSPANP00000015658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]