SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015759 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015759
Domain Number 1 Region: 1473-1612
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.57e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000221
Further Details:      
 
Domain Number 2 Region: 259-347
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000371
Family Calponin-homology domain, CH-domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015759   Gene: ENSPANG00000026116   Transcript: ENSPANT00000028542
Sequence length 1617
Comment pep:known_by_projection chromosome:PapAnu2.0:15:2370336:2463771:1 gene:ENSPANG00000026116 transcript:ENSPANT00000028542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDAGGRAAAEGWRKMEAPPDGAADLVPLDRYDAARAKIAANLQWICAKAYGRDNIPEDL
RDPFYVDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQVAALQGHQSVIQALSRKGIY
VMESDDTPVTESDLSRAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKE
LPYDLEDAMVFWINKVNLKMREITEKEVKLKQQLLESPAHQKPGLAHAVVHCMLEPVEFA
RVVRYRREHLSARQSPYFPLLEDLMRDGSDGAALLAVIHYYCPEQMKLDDICLKEVTSMA
DSLYNIRLLREFSNEYLNKCFYLTLEDMLYAPLVLKVITNYLWWFENVKPDFVQPRDVQE
LKDAKTVLHQKSSRPPVPISNATKRSFLGSPAAGTSADLQPPAQLPADGCHRHYLHPEEP
EYLGKGTAAFSPSHPLLPLRQKQQKSIQGEDIPDQRHRSNSLTRVDGQPRGAAIAWPEFF
YTPASQPTPFALHHAASCEVDPSSGDSISLARSISKDSLASNIVNLTPQNQPHPTAVKTH
GKSLLNNVSIEDEEEELVAIVRADVAPQQADLEFPRASPRASGLIASARSPQGQLDTSES
KPDSFFLEPLMPAVLKPAKEKQVITKEDERGEGRPRSIASRRPSEGPQPLVRRKVTGSRD
LNRTFTPIPCSEFPMGIDPTETGPQSVETMGEVCGGPLALGGFDPFPLGPSTDGFFLHVD
RADEDTEGRLYVSCSKSPNSHDSEPWTLLRQDSDSDVVDIEEAEHDFLGEAHPVVLSRYI
GEEESAKLQEDMKVKEHEDKDDASGRSSPCLSTASQMSSVSVASGSVKMTSFAERKLQRL
NSCETKSSTSSSQKTTPDASESCPAPLTTWRQKREQSPGRHGRDPASLLASELVQLHMQL
EEKRRAIEAQKKKMEALSARQRLKLGKAAFLHVVKKGKAEAALPLRPEHFSKEYSQHNGE
DCGDGVSKTEDFLVKEEQREELLHEPQDVDKESLAFAQQHKAKDPVALHELERNKVISAA
LLEDTVGEVVDVNECDLSIEKLNETISTLQQAILKISQQQEQLLLKSPTVPVPGSKSNSQ
DHKVKAPVHFVEPLSPTGVAGHRKAPRLGQGRNSRSGRPAELKVPKDRPQGSSRSKTPTP
SVETLPHLRPFPASSHPRTPTDPGLDGALEPSSDPHGKCLFDSYRLHDESNQRTLTLSSS
KDTNILSEQMSLKEVLDASVKEAVPSSSDVSGKESIPVEEPLRSRASLIEVDLSDLKAPD
EDGELASLDGSADLISEGDQKPGVGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEARVRK
QQLEAEVELKRDEARRKAEEDRVRKEEEKARRELIKQEYLRRKQQQILEEQGLGKPKSKP
KKPRPKSVHREESCSDSGTKCSSTPDNLSRTQSGSSLSLASAATTEPESVHSGGTPSQRV
ESMEALPILSRNPSRSTDRDWETASAASSLASVAEYTGPKLFKEPSSKSNKPIIHNAISH
CCLAGKVNEPHKNSILEELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPK
NITKKMIDKLYKYSSDRKQFNLIPAKTMSVSVDALTIHNHLWQPKRPAVPKKGQTRK
Download sequence
Identical sequences ENSPANP00000015759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]