SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015867 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015867
Domain Number 1 Region: 299-512
Classification Level Classification E-value
Superfamily Kelch motif 4.45e-51
Family Kelch motif 0.00027
Further Details:      
 
Domain Number 2 Region: 27-145
Classification Level Classification E-value
Superfamily POZ domain 1.96e-34
Family BTB/POZ domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015867   Gene: ENSPANG00000012339   Transcript: ENSPANT00000024437
Sequence length 544
Comment pep:known_by_projection chromosome:PapAnu2.0:10:61712941:61775624:-1 gene:ENSPANG00000012339 transcript:ENSPANT00000024437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEQEFTQLCKLPAQPSHPHCVNNTYRSAQHSQALLRGLLALRDSGILFDVVLVVEGRH
IEAHRILLAASCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTSELELSLSNV
QETLVAACQLQIPEIIHFCCDFLMSWVDEENILDVYRLAELFDLSRLTEQLDTYILKNFV
AFSRTDKYRQLPLEKVYSLLSSNRLEVSCETEVYEGALLYHYSLEQVQADQISLHEPPKL
LETVRFPLMEAEVLQRLHDKLDPSPLKDTVASALMYHRNESLQPSLQSPQTELRSDFQCV
VGFGGIHSTPSTVLSDQAKYLNPLLGEWKHFTASLAPRMSNQGIAVLNNFVYLIGGDNNV
QGFRAESRCWRYDPRHNRWFQIQSLQQEHADLSVCVVGRYIYAVAGRDYHNDLNAVERYD
PATNCWAYVAPLKREVYAHAGATLEGKMYITCGRRGEDYLKETHCYDPGSNTWHTLADGP
VRRAWHGMATLLSKLYVIGGSNNDAGYRRDVHQLPGAHVLRWLEAARGRVWDCGVRRQLD
VLGE
Download sequence
Identical sequences ENSPANP00000015867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]