SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015941 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015941
Domain Number 1 Region: 21-148
Classification Level Classification E-value
Superfamily E set domains 1.26e-42
Family ML domain 0.000000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015941   Gene: ENSPANG00000013438   Transcript: ENSPANT00000023003
Sequence length 201
Comment pep:known_by_projection chromosome:PapAnu2.0:7:130549400:130568031:-1 gene:ENSPANG00000013438 transcript:ENSPANT00000023003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVT
FTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYP
SIKLVVEWQLQDDKNQSLFCWEIPVQIVFPCLFSARCPMLATEHRCLQFQMETKSLRFWS
RRGMSVRVPSPAGAWRRTAPF
Download sequence
Identical sequences G7PAU7
ENSPANP00000015941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]