SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016089 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016089
Domain Number 1 Region: 391-420,453-557,679-794
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.38e-56
Family Phosphate binding protein-like 0.0000000761
Further Details:      
 
Domain Number 2 Region: 72-376
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.18e-24
Family L-arabinose binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016089   Gene: ENSPANG00000020268   Transcript: ENSPANT00000017859
Sequence length 1199
Comment pep:known_by_projection chromosome:PapAnu2.0:16:66209631:66228533:-1 gene:ENSPANG00000020268 transcript:ENSPANT00000017859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGALGPALLLTSLFGAWAGPGPGQGEQGMTVAVVFGSSGPPQAQVRARLTPQSFLDLPL
EIQPLTVGVNNTNPSSLLTQICGLLGAARVHGIVFEDNVGTEAVAQILDFISSQTHVPIL
SISGGSAVVLSPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAVITSLHPGHALFLE
GVRAVADASHLSWRLLDVVTLELGPGGPRARTQRLLRQLDAPVFVAYCSSEEAEVLFAEA
AQAGLVGPGHVWLVPNLALGSTDAPPATFPVGLISVVTESWRLSLRQKVRDGVAILALGA
HGYRRQHGTLPAPAGDCRAHPGPVSPAREAFYRHLLNVTWEGRDFSFSPGGYLVQPTMVV
IALNRHRLWEMVGRWEHGVLYMKYPVWPRYSASLQPVVDSRHLTVATLEERPFVIVESPD
PGTGGCVPNTVPCRRQSNHTFSSGDVAPYTKLCCKGFCIDILKKLARVVKFSYDLYLVTN
GKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNG
TVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTRGKKSGGPSFTIG
KSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTV
SGLSDKKFQRPQEQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKM
GKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQF
LGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVY
WKLRHSVPNTSQLDFLLAFSRGIYSCFSGVQSLASPPRQPSPDLTASSAQASVLKMLQAA
RDMVTTAGVSSSLDRATRTIENWGGGRRAPPPEPSPRGWRPPGGGRAALVRRAPQPPGRP
PTPGPPLPDVSRVSRRPAWEARWPVRAGHCGRHLSASERRALPERPLSPARCHYSSFPRA
DRSGRPFLPLFPEPPEPEDLPLLGLEQLARREALLHAAWARGSRPRHASLPSSLAEAFAR
PSSLPAGCTCLTCARPDGHSACRRLAQAQSMCLPTYREACQEGEQAGAPTWQHRQHVCLH
AHAHLPFCWGAVCPHLPPCASQGSWLSGGLDEVSRVACGTQGFPGPCTWRRISSLESEV
Download sequence
Identical sequences ENSPANP00000016089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]