SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016090 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016090
Domain Number 1 Region: 139-362
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.5e-55
Family C-terminal domain of adrenodoxin reductase-like 0.00000000479
Further Details:      
 
Domain Number 2 Region: 37-198
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.3e-20
Family N-terminal domain of adrenodoxin reductase-like 0.00000597
Further Details:      
 
Domain Number 3 Region: 340-490
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000294
Family N-terminal domain of adrenodoxin reductase-like 0.000000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016090   Gene: ENSPANG00000020236   Transcript: ENSPANT00000017858
Sequence length 491
Comment pep:known_by_projection chromosome:PapAnu2.0:16:66228716:66239936:-1 gene:ENSPANG00000020236 transcript:ENSPANT00000017858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCWRWWGWSVWPRTRPPPAGSTPSFRHHLSTQEKTPQICVVGSGPAGFYTAQHLLKH
PQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVP
ELREAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENRELEPDLSCDTAV
ILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKE
LREMIQLPGARPILDPADFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPEEAARRASAS
RAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVGEATRAVPTGDMEDLPCGLVLSSV
GYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQM
LLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLV
DPQEMLRLLGH
Download sequence
Identical sequences A0A096NSR9
ENSPANP00000016090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]