SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016116 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016116
Domain Number 1 Region: 36-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 3.66e-50
Family Ribosomal protein S7 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016116   Gene: ENSPANG00000020157   Transcript: ENSPANT00000019039
Sequence length 242
Comment pep:known_by_projection chromosome:PapAnu2.0:16:66645284:66652528:1 gene:ENSPANG00000020157 transcript:ENSPANT00000019039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVGELTE
EEKYDRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMKGGNKVLARSLVTQTLEAVKR
KQFEKYHSASAEEQATIERNPYTIFHQALKNCEPVIGLVPILKGGRFYQVPVPLPDKRRR
FLAMKWMITECRENKHRRTLMPEKLSHELLEAFHNRGPVIKRKHEMHKMAEANRALAHYR
WW
Download sequence
Identical sequences A0A2I3N5C1
ENSPANP00000016116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]