SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Papio anubis 76 > ENSPANP00000016121

Domain assignment for ENSPANP00000016121 from Papio anubis 76

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSPANP00000016121
Domain Number 1	Region: 201-262
Classification Level	Classification	E-value
Superfamily	FF domain	0.00000000000000484
Family	FF domain	0.0000729
Further Details:

Domain Number 2	Region: 262-322
Classification Level	Classification	E-value
Superfamily	FF domain	0.0000000000183
Family	FF domain	0.0046
Further Details:

Domain Number 3	Region: 89-126
Classification Level	Classification	E-value
Superfamily	WW domain	0.000000283
Family	WW domain	0.005
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSPANP00000016121 Gene: ENSPANG00000020163 Transcript: ENSPANT00000028892
Sequence length	340
Comment	pep:known_by_projection chromosome:PapAnu2.0:9:122567347:122745907:-1 gene:ENSPANG00000020163 transcript:ENSPANT00000028892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MVSMDPESLRGPSPSSVQPCHFLTLAPIKIPLRTSPFSDTRTERGGVARPPALMLRAQKK SRAGDKEDKEPPPMLGGGEDSTARGNRPVASTPVPGSPWCVVWTGDDRVFFFNPTMHLSV WEKPMDLKDRGDLNRIIEDPPHKRKLEAPATDNSDGSSSEDGREDPDVKTKRNRTEGCGS PRPEEAKREDKGTRTPPPQILLPLEERVTHFRHMLLERGVSAFSTWEKELHKIVFDPRYL LLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKEFAEKYG RDQRFRLVQKRKDQEHFFNQFILILKKRDKENRLRLRKMR
Download sequence
Identical sequences	ENSPANP00000016121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]