SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016438 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016438
Domain Number 1 Region: 343-689
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.64e-91
Family YicI catalytic domain-like 0.00014
Further Details:      
 
Domain Number 2 Region: 693-775
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.81e-22
Family Putative glucosidase YicI, domain 3 0.009
Further Details:      
 
Domain Number 3 Region: 70-160,211-341
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000000000000973
Family YicI N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016438   Gene: ENSPANG00000018629   Transcript: ENSPANT00000021938
Sequence length 858
Comment pep:known_by_projection chromosome:PapAnu2.0:7:16852105:16941781:1 gene:ENSPANG00000018629 transcript:ENSPANT00000021938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAEKEEISVEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSAYQALLDSVTTDEDSTRFQ
IINEASKVTLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGS
LILADGKGGLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEEA
SVDTSQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDEDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLSQMGPVAAKQKVKSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKKRFPNPKR
MQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHREL
HNIYGFYHQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSITGISFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNAKRREPWLFGK
EHTRLIREAIRERYGLLPYWYSLFYHAHVASQPVMRPLWVEFPDELKTFDMEDEYMLGSA
LLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVVP
IKTTVGKSTGWMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLHQKQFLHRKFSFCXXX
XXXXXXXXXXXXXXNSIS
Download sequence
Identical sequences ENSPANP00000016438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]