SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016792 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016792
Domain Number 1 Region: 86-223
Classification Level Classification E-value
Superfamily FKBP-like 1.79e-37
Family FKBP immunophilin/proline isomerase 0.000000929
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016792
Domain Number - Region: 25-88
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00518
Family Mevalonate 5-diphosphate decarboxylase 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016792   Gene: ENSPANG00000026275   Transcript: ENSPANT00000009962
Sequence length 224
Comment pep:novel chromosome:PapAnu2.0:7:101740883:101759097:-1 gene:ENSPANG00000026275 transcript:ENSPANT00000009962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLV
TAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGD
KTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALL
TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLIFEVELVDID
Download sequence
Identical sequences A0A096NUR8 A0A0D9RS20 A0A2K5IMW6 A0A2K5LJG3 A0A2K6B3L9 A0A2K6NJQ1 F7G0S7 G1QWN8 H2NL52 Q4R5C5
9544.ENSMMUP00000021697 9600.ENSPPYP00000006568 ENSPPYP00000006568 NP_001270679.1.63531 XP_002824756.1.23681 XP_003263793.1.23891 XP_008018962.1.81039 XP_010387598.1.97406 XP_011802461.1.43180 ENSMMUP00000021697 ENSPANP00000016792 ENSMMUP00000021697 ENSPPYP00000006568 ENSNLEP00000005359 ENSNLEP00000005359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]