SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016806 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016806
Domain Number 1 Region: 1-40
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 0.0000000000353
Family Nucleoplasmin-like core domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016806   Gene: ENSPANG00000016748   Transcript: ENSPANT00000026301
Sequence length 190
Comment pep:novel chromosome:PapAnu2.0:7:104363873:104364515:1 gene:ENSPANG00000016748 transcript:ENSPANT00000026301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATLKRSVQSTVSLGGCEIRPPVVLKLKCASGPVHIIGQHLAAVEEDAESEDEEEEDGKLL
SISGKRSAPGGGSKVPQKKVKLAKEAEEKAPVKKSIRDTLVKNAQKSNHNGQDSKPSSTP
RSKGQESEKTLKTPKGPSSVEDIKAKMQASIEKGGSLPNVEAKFISYVKSCFWMTNQEAI
QDLWQWRKSL
Download sequence
Identical sequences ENSPANP00000016806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]