SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016812 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016812
Domain Number 1 Region: 168-333
Classification Level Classification E-value
Superfamily Kelch motif 2.75e-32
Family Kelch motif 0.015
Further Details:      
 
Domain Number 2 Region: 13-163
Classification Level Classification E-value
Superfamily Kelch motif 8.76e-27
Family Kelch motif 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016812   Gene: ENSPANG00000017514   Transcript: ENSPANT00000018918
Sequence length 406
Comment pep:known_by_projection chromosome:PapAnu2.0:7:106185382:106245746:1 gene:ENSPANG00000017514 transcript:ENSPANT00000018918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSQLFCVAEERSGHCAVVDGNFLYVWGGYVSIEDNEVYLPNDEIWTYDIDSGLWRMHL
MEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVNLRTRDGTYIWEKITNFEGQP
PTPRDKLSCWVYKDRLIYFGGYGCRRHSELQDCFDVHDASWEEQIFWGWHNDVHIFDTKT
QTWFQPEIKGGVPPQPRAAHMCAVLGNKGYIFGGRVLQTRMNDLHYLNLDNWTWSGRITI
NGESPKHRSWHTLTPIADDKLFLCGGLSADNIPLSDGWIHNVTTNCWKQLTHLPKTRPRL
WHTACLGKENEIMVFGGSKDDLLALDTGHCNDLLIFQTQPYSLLRSCLDCIGKNSIMLES
QISLLPPKLLQQVLKKITFWAAANHREEQRVQKEETEKKYQWISSN
Download sequence
Identical sequences A0A096NUT7
ENSPANP00000016812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]