SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016813 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016813
Domain Number 1 Region: 191-357
Classification Level Classification E-value
Superfamily Kelch motif 8.89e-31
Family Kelch motif 0.012
Further Details:      
 
Domain Number 2 Region: 28-165
Classification Level Classification E-value
Superfamily Kelch motif 3.14e-22
Family Kelch motif 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016813   Gene: ENSPANG00000009939   Transcript: ENSPANT00000013621
Sequence length 406
Comment pep:known_by_projection chromosome:PapAnu2.0:7:106265188:106280868:1 gene:ENSPANG00000009939 transcript:ENSPANT00000013621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGNEDMRADDLPGPAFESYESMELACPAERSGHVAVSDGRHMFVWGGYKSNQVRGLYD
FYLPREELWIYNMETGRWKKINTEGDVPPSMSGSCAVCVDRVLYLFGGHHSRGNTNKFYM
LDSRSTDRVLQWERIDCQGIPPSSKDKLGVWVYKNKLIFFGGYGYLPEDKVLGTFEFDET
SFWNSSHPRGWNDHVHILDTETFTWSQPITTGKTPSPRAAHACATVGNRGFVFGGRYRDA
RMNDLHYLNLDTWEWNELIPQGICPVGRSWHSLTPVSSDHLFLFGGFTTDKQPLSDAWTY
CISKNEWIQFNHPYTEKPRLWHTACASDEGEVIVFGGCANNLLVHHRAAHSNEILIFSVQ
PKSLVRLSLEAVICFKEMLANSWNCLPKHLLHSVNQRFGSNNTSGS
Download sequence
Identical sequences A0A096NUT8 A0A2K5M8Z2 A0A2K6A0G9 A0A2K6DNR1 F7AKA8 G7PA76
ENSPANP00000016813 ENSMMUP00000032928 XP_005561253.1.63531 XP_011739953.1.29376 XP_011855152.1.47321 XP_011917129.1.92194 XP_014999142.1.72884 9544.ENSMMUP00000032935 ENSMMUP00000032935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]