SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016979 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016979
Domain Number 1 Region: 331-612
Classification Level Classification E-value
Superfamily Kelch motif 4.84e-45
Family Kelch motif 0.0032
Further Details:      
 
Domain Number 2 Region: 752-898
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-24
Family C-type lectin domain 0.0031
Further Details:      
 
Domain Number 3 Region: 104-219
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-22
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1032-1078
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000356
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016979
Domain Number - Region: 71-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00268
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016979   Gene: ENSPANG00000004319   Transcript: ENSPANT00000022862
Sequence length 1398
Comment pep:known_by_projection chromosome:PapAnu2.0:10:36278307:36451640:1 gene:ENSPANG00000004319 transcript:ENSPANT00000022862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAAAATEARLRRRTAATAALAGRSGGPHRDWDVTRAGRPGLGAGLRLARLLSPPLRPP
RVSGSAAAEAKECDRPCVNGGRCNPGTGQCVCLAGWVGEQCQHCGGRFRLTGSSGFVTDG
PGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWDHLYVYDGDSIYAPLVAAFSGLIVP
ERDGNETVPEVVATSGYALLHFFSDAAYNLTGFNITYSAAVELLLEEGDFSANGQKHWNF
TKYSSTNISSCHVLNNSELHCFKALSVQVSYVIMGCIIVSSLESPGCSVPVPANQSFWTR
EEYSNLKLPRASHKAVVSGNIMWVVGGYMFNHSDYNMVLAYDLASREWLPLNRSVNNVVV
RYGHSLALYKDKIYMYGGKIDSTGNVTNELRVFHIHNESWVLLTPKAKEQYAVVGHSSHI
VTLKNGRVVMLVIFGHCPLYGYISNVQEYDLDKNTWSILHTQGALVQGGYGHSSVYDHRT
RALYVHGGYKAFSANKYRLADDLYRYHVDTQMWTILKDSRFFRYLHTAVIVSGTMLVFGG
NTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLPRPDLHHDVNRFGHSAVLHNSTMYVFGG
FNSLLLSDILVFTSEQCDGHRSEAACLAAGPGIRCVWDTGSSQCISWALATDEQEEKLKS
ECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCNDHCVPRNHSCTEGQISIFRYENCPKDN
PMYYCNKKTSCRSCALDQNCQWEPRNQECIALPENICGIGWHLVGNSCLKITTAKENYDN
AKLFCRNHNAVLASLTTQKKVEFVLKQLRIMQSSQSMSKLTLTPWVGLRKINVSYWCWED
MSPFTNSLLQWMPSEPSDAGFCGILSEPSTRGLKAATCINPLNGSVCERPANHSAKQCRT
PCALRTACGECTSGSSECMWCSNMKQCVDSNAYVASFPFGQCMEWYTMSTCPPENCSGYC
TCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGPVKMPSQAPTGNFYPQPLLNSSMCLEDS
RYNWSFIHCPACQCNGHSKCINQSICEKCENLTTGKHCETCISGFYGDPTNGGKCQPCKC
NGHASLCNTNTGKCFCTTKGVKGDECQLCEVENRYQGNPLKGTCYYTLLIDYQFTFSLSQ
EDDRYYTAINFVATPDEQNRDLDMFINASKNFNLNITWAASFSAGTQAGEEMPVVSKTNI
KEYKDSFSNEKFDFRNHPNITFFVYVSNFTWPIKIQIAFSQHSNFMDLVQFFVTFFSCFL
SLLLVAAVVWKIKQSCWASRRREQLLREMQQMASRPFASVNVALETDEEPPDLIGGSIKT
VPKPIALEPCFGNKAAVLSVFVRLPRGLGGIPPPGQSGLAVASALVDISQQMPIVYKEKS
GAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences ENSPANP00000016979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]