SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017245 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017245
Domain Number 1 Region: 242-347
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.2e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000018
Further Details:      
 
Domain Number 2 Region: 93-199
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000123
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 10-62
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000407
Family HLH, helix-loop-helix DNA-binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017245   Gene: ENSPANG00000013264   Transcript: ENSPANT00000007487
Sequence length 870
Comment pep:known_by_projection chromosome:PapAnu2.0:13:45337648:45374741:1 gene:ENSPANG00000013264 transcript:ENSPANT00000007487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTPSSPLRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAI
SFRTHKLLSQVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLT
QVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRT
VNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSK
TFLSRHSMDMKFTYCDDRKLRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTK
GQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQT
ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQ
NFEESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSCS
TPNSPEDYYTSLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDF
QLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPE
HRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTE
FLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQ
DLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNGKFTQNPVRGLGHPLRHL
PLPQPPSAVSPGENSKSRFPAQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELT
RYDCEVNVPVLGSSTLLQGGDLLRALDQAT
Download sequence
Identical sequences ENSPANP00000017245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]