SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017294 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017294
Domain Number 1 Region: 713-812,971-1137,1206-1267
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.12e-45
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 
Domain Number 2 Region: 10-407
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.96e-41
Family Quinoprotein alcohol dehydrogenase-like 0.04
Further Details:      
 
Domain Number 3 Region: 1566-1640,1692-1837,1895-1963
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.88e-38
Family WD40-repeat 0.0048
Further Details:      
 
Domain Number 4 Region: 319-598
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.01e-35
Family WD40-repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 1400-1551,1600-1768
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.45e-31
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Domain Number 6 Region: 864-948
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000282
Family Quinoprotein alcohol dehydrogenase-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017294   Gene: ENSPANG00000026170   Transcript: ENSPANT00000019602
Sequence length 1969
Comment pep:known_by_projection chromosome:PapAnu2.0:7:144711397:144901743:-1 gene:ENSPANG00000026170 transcript:ENSPANT00000019602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARSAPSSHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFYRGH
SDDIISLALHPERVLVATGQVGKEPYICIWDSYTVQTISVLKDVHTHGIACLAFDLDGQR
LVSVGLDSKNAVCVWDWKRGKMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLC
GNALTPKRGVFGKTGDLQTILCLACARDELTYSGALNGDIYVWKGINLIRTIQGAHAAGI
FSMNACEEGFATGGRDGCIRLWDLTFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGT
QDSEIFEIVVQERNKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVDHALI
ARCNMEEPIRCAAVNADGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDG
TYLAVGCNDSSVDIYGVAQRYKKVGECLGSLSFITHLDWSSDSRYLQTNDGNGKRLFYRM
PGGKEVTSTEEIKGVHWASWTCVSGLEVNGIWPKYSDINDINSVDGNYIGQVLVTADDYG
IIKLFRYPCLRKGAKFRKYIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWKFIPERKLK
DALHIAPQESLADSHSDESDSDLSDVPELDSEIEQETQLTYRRQVYKEDLPQLKEQCKEK
QKSATSKRRERAPGNSIRLHFVHGYRGYDCRSNLFYTQIGEIVYHVAAVGVIYNRQQNTQ
RFYLGHDDDILCLTIHPLKDYVATGQVGRDPSIHIWDTETIKPLSILKGHHQCGISAVDF
SADGKRLASVGIDDSHTIVLWDWKKGEKLSIARGSKDKIFVVKMNPYVPDKLITAGIKHM
KFWRKAGGGLIGRKGYIGTLGKNDTMMCAVYGWTEEMAFSGTSTGDVCIWRDIFLVKTVK
AHDGPVFSMHALEKGFVTGGKDGIIALWDDSFERCLKTYAIKRAALAPGSKGLLLEDNPS
IRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLATHPYLPICATVSDDK
TLRIWDLSPSHCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLMANADTLEDLVSFHH
RKDMISDIRFSPGSGKYLAVASHDSFIDIYNVMSSKRVGICKGATSYITHIDWDIRGKLL
QVNTGAKEQLFFEAPRGKKQTIPSVEVEKIAWASWTSVLGLCCEGIWPVIGEVTDVTASC
LTSDKMVLATGDDLGFVKLFRYPTKGKFGKFKRYVAHSTHVTNVRWTYDDSMLVTLGGTD
MSLMVWTNEMEGYREKRPCDSEESDIDSEEDGGYDSDVTRENEISYTIRALSTNIRPMFG
IKPHLQQKEPSTDERPPVSRAPPQPEKLQTNNVGKKKRPIEDLVLELVFGYRGRDCRNNV
HYLNDGDDIIYHTASIGILHNVATGSQSFYQEHNDDILCLTVNQHPKFINIVATGQVGDS
ADMSAAAPSIHIWDAMNKQTLSILRCYHSKGVCSVSFSATGKLLLSVGLDPEHTITIWRW
QEGAKIASRAGHNQRIFVAEFRPDSDTQFVSVGVKHVKFWTLAGRALLSKKGLLSTLEDA
RMQTMLAIAFGANNLTFTGTISGDVCVWKDHILCRIVARAHNGPVFAMYTTLRDGLIVTG
GKERPSKEGGAVKLWDQELRRCRAFRLETGQATDCVRSVCRGKGKILVGTRNAEIIEVGE
KNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAART
VCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAVGSSENS
VDFYDLTLGPTLNRISYCKDIPSFVIQMDFSADSRYLQVSSGCYKRHVYEVPSGKHLMDH
AAIDRITWATWTSILGDEVLGIWSRHAEKADVNCACVSHSGISLVTGDDFGMVKLFDFPC
PEKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLLVWKCVHTPH
Download sequence
Identical sequences A0A096NW69
ENSPANP00000017294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]