SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017333 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017333
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000249
Family LysM domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017333   Gene: ENSPANG00000008738   Transcript: ENSPANT00000000507
Sequence length 227
Comment pep:known chromosome:PapAnu2.0:1:124956843:124961916:-1 gene:ENSPANG00000008738 transcript:ENSPANT00000000507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQPPPGGSGLLHGSRARSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEEVHPSNDEVWPHS
TERKKQETGAGRANGEVFPTPGQETPTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGE
SGVPGEDAGLHLSSPRMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
Download sequence
Identical sequences A0A096NWA6 A0A2K5MSC7 A0A2K5ZBW8 A0A2K6MX43 A0A2K6RAW3 G8F2C1
ENSPANP00000017333 XP_010385519.1.97406 XP_010385520.1.97406 XP_010385521.1.97406 XP_011828950.1.47321 XP_011924935.1.92194 XP_011924937.1.92194 XP_011924938.1.92194 XP_017733223.1.44346 XP_017733224.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]