SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017373 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017373
Domain Number 1 Region: 348-488
Classification Level Classification E-value
Superfamily C-type lectin-like 1.66e-33
Family C-type lectin domain 0.00063
Further Details:      
 
Domain Number 2 Region: 210-348
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-33
Family C-type lectin domain 0.00058
Further Details:      
 
Domain Number 3 Region: 1371-1515
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-28
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 4 Region: 949-1092
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-27
Family C-type lectin domain 0.004
Further Details:      
 
Domain Number 5 Region: 1107-1223
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-26
Family C-type lectin domain 0.00096
Further Details:      
 
Domain Number 6 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2e-25
Family Cysteine rich domain 0.01
Further Details:      
 
Domain Number 7 Region: 634-792
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-25
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 8 Region: 501-625
Classification Level Classification E-value
Superfamily C-type lectin-like 9.8e-19
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 9 Region: 1239-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-17
Family C-type lectin domain 0.0067
Further Details:      
 
Domain Number 10 Region: 818-932
Classification Level Classification E-value
Superfamily C-type lectin-like 1.82e-16
Family C-type lectin domain 0.014
Further Details:      
 
Domain Number 11 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000137
Family Fibronectin type II module 0.0024
Further Details:      
 
Domain Number 12 Region: 1525-1606
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000962
Family C-type lectin domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017373   Gene: ENSPANG00000011792   Transcript: ENSPANT00000001619
Sequence length 1609
Comment pep:novel chromosome:PapAnu2.0:12:21655480:21748363:-1 gene:ENSPANG00000011792 transcript:ENSPANT00000001619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTDWATPRRPAGLLMLLLWCFELAEPSGRAANDPFTIVHGNTGKCIKPVYGWIVAEDCD
ETEDKLWKWVSQHRLFHLHSQKCLGLDITKSVNEVRMFSCDSSVMLWWKCEHHSLYSAAR
YQLALKNGHGAAISNASDIWKKGGSEESLCDQPYHEIYTRDGNSYGRPCEFPFLVDGTWH
HDCILDEDHSGPWCATTLNYEYDRKWGICLKPENGCEDNWEKNEQFGSCYQFNTQTALSW
KEAYVSCQNQEADLLSINSAAELTYLKEKEGIAKIFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDRPSAPTIGGSSCARMDAESGLWQSFSCDAQLPYVCRKPLNSTVELTDVWTYSDTR
CDAGWLPNNGFCYLLVNESNSWDKAHAKCKDFSGDLISIHSLADVEVVVTKLHNEDTKEE
VWIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEK
LKYVCKRKGEKLNDTSSDKMCPPNEXWKRHGETCYKIYEDEVPFGTNCNLTITSRFEQEY
LNDLMKKYDKSLRKYFWTGLRDADSRGEYNWATVGGTRRSVTFSNWNFLEPASPGGCVAM
STGKSLGKWEVKDCRSFKALSICKKMSGPLEPEEAAPKPDDPCPEGWQSFPTSLSCYKVF
HAERIVRKRNWEEAERFCQALGAHLSSFSRVDEIKEFLHFLTDQFSGQRWLWIGLNKRSP
DLQGSWQWSDRTPVSTIIMPNEFQQDYDIRDCAAVKVFHRPWRRGWHFYDDREFIYLRPF
ACDTKLEWVCQIPKGRTPKTPDWYNPERAGIHGPPLIIEGSEYWFVADLHLNYEEAVLYC
ASNHSFLATITSFAGLKAIKNKIANISGDGQKWWIRINEQPIDDHFTYSRYPWHRFPVTF
GEECLYMSAKTWLIDLSKPTDCNTKLPFICEKYNVSSLEKYSPDSAAKVQCSEQWIPFQN
KCFLKIKPMSLTFSQASDTCHSYGGTLPSVLSQIEQDFITSLLPDMEATLWIGLRWTAYE
RINKWTDNRELTYSNFHPLLVSRRLRIPENLFEEESHYHCALILNLQKSPFIGTWNFTSC
SERHFVSLCQKYSEVKGRQTLQNASETVKYLNNLYKIIPKTLTWHGAQKECLKNNMQLVS
ITDPYQQAFLSVQALLHNSSLWIGLFSQDDELNFGWSDGKRLHFSRWAETNGQLEDCVIL
DTDGFWKTADCNDNQSGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYNFII
TKNRHMATTLDEVHSKCQKLNPKSQILSIRDEKENNFVLEQLLYFNYMASWVTLGITYKN
NSLMWFDKTPLLYTHWRAGRPTIKNEKFLAGLSTDGFWDIKTFNVIEETLYFHQHSILAC
KIEMVDYKEEYNTTLPQFMPYEDGIYSVIQKKVTWYEALNMCSQSGGHLASVHDQNGQLF
LEDIVKRDGFPLWVGLSSHDGSESSFEWSDGSIFDYIPWKGQTSPGNCVLLDPKGTWKHE
KCNSVKDGAICYKPTKSKKLSHLTYSSRCPTVKENGSRWIQYKGHCYTSDQALHSFSEAK
KLCSKHDQSATIVSIKDEDENKFVSRMMRENNNITMRVWLGLSQHSVGK
Download sequence
Identical sequences ENSPANP00000017373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]