SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017379 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017379
Domain Number 1 Region: 41-192
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 3.92e-83
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000585
Further Details:      
 
Domain Number 2 Region: 201-367
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.55e-37
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017379   Gene: ENSPANG00000008528   Transcript: ENSPANT00000013067
Sequence length 464
Comment pep:known_by_projection chromosome:PapAnu2.0:3:177043770:177053178:-1 gene:ENSPANG00000008528 transcript:ENSPANT00000013067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEMLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAGNLYLQKXGGCFPGSATVHLEQGTKLVKDLRPGDRVLAADDQGRLLYSDF
LTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSAAAEPEAFSGAGPPFEGA
LGHRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLREEAAGAYAPLTAQGTILINR
VLASCYAVIEEHGWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGSRVPPPAP
GAADATGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS
Download sequence
Identical sequences ENSPANP00000017379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]