SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017471 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017471
Domain Number 1 Region: 21-412
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-56
Family L-arabinose binding protein-like 0.0042
Further Details:      
 
Domain Number 2 Region: 418-565,682-820
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.5e-55
Family Phosphate binding protein-like 0.0000000000964
Further Details:      
 
Domain Number 3 Region: 572-677,711-739
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000144
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017471   Gene: ENSPANG00000026295   Transcript: ENSPANT00000028752
Sequence length 959
Comment pep:known_by_projection chromosome:PapAnu2.0:15:1045119:1074535:-1 gene:ENSPANG00000026295 transcript:ENSPANT00000028752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRL
ETLLEERESKSKKRNYENLDQLSYDNKRGPKAEKVLQFDPGTKNVTALLMEAKELEARVI
ILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVE
FNEDGDRKFANYSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLK
IVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
IDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTI
NNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYL
LDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGF
AMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVEL
STMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFML
VAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKAT
FRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
Download sequence
Identical sequences A0A096NWP3 A0A0D9RVD4 A0A2J8N9K1 A0A2J8RMK6 A0A2K5NN32 A0A2K5USV1 A0A2K6MT38 F7GR67
XP_005266130.1.92137 XP_005580402.1.63531 XP_008003700.1.81039 XP_011904245.1.92194 XP_014971750.1.72884 XP_017748524.1.44346 ENSPANP00000017471 ENSP00000360605 ENSP00000360601 ENSP00000360601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]