SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017496 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017496
Domain Number 1 Region: 30-514
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-169
Family ALDH-like 0.00000000000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017496   Gene: ENSPANG00000010286   Transcript: ENSPANT00000025762
Sequence length 518
Comment pep:known_by_projection chromosome:PapAnu2.0:1:188746848:188786526:-1 gene:ENSPANG00000010286 transcript:ENSPANT00000025762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLRAGLAALSPLVRSLQPSPVAAMSTGTFVVSQPLNYRGGARVEPADASGTEKAFEPAT
GRVIATFTCSGEKEVNLAVQNAKAAFKIWSKKSGMERCRILLEAARIIREREDEIATVEC
INNGKSIFEARLDIDTSWQCLEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYTEAGVPPGLFNVVQGGAATG
QFLCQHHDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMNNAVKGA
LMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHL
ERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPV
MSILSFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF
Download sequence
Identical sequences A0A096NWR4
ENSPANP00000017496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]