SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017513 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017513
Domain Number 1 Region: 148-219,266-535
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 4.21e-97
Family NadC C-terminal domain-like 0.0000166
Further Details:      
 
Domain Number 2 Region: 15-147
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.55e-36
Family NadC N-terminal domain-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017513   Gene: ENSPANG00000017234   Transcript: ENSPANT00000019298
Sequence length 538
Comment pep:known_by_projection chromosome:PapAnu2.0:8:138430729:138434112:-1 gene:ENSPANG00000017234 transcript:ENSPANT00000019298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEQDPEGLAAARPLLTDLYQATMALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGL
RDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRSLDCSEVTVRALPEGSLAFPGVP
LLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGL
TASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGEGPGV
DLAAKAQVWLEHVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDSYSVRRSGLPNF
LAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVPIAVSNNIDE
EALARLAQEGSEVNVIGIGTSVVTCPQQPSLGCVYKLVAVGGQPRMKLTEDPEKQTLPGS
KAAFRLLGSDGSLLMDVLQLAEEPAPQAGQELRVWPPGAQEPCTVRPAQVEPLLWLCLQQ
GQLCEPLPSLAESRALVQLSLSQLSPEHRRLQSPAQYQVVLSERLQALVNSLHARASP
Download sequence
Identical sequences ENSPANP00000017513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]