SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017612 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017612
Domain Number 1 Region: 422-615
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.83e-58
Family Hemopexin-like domain 0.00000000568
Further Details:      
 
Domain Number 2 Region: 23-122,296-353
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.59e-43
Family Matrix metalloproteases, catalytic domain 0.000000436
Further Details:      
 
Domain Number 3 Region: 244-299
Classification Level Classification E-value
Superfamily Kringle-like 8.57e-22
Family Fibronectin type II module 0.00011
Further Details:      
 
Domain Number 4 Region: 183-240
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-21
Family Fibronectin type II module 0.000075
Further Details:      
 
Domain Number 5 Region: 128-182
Classification Level Classification E-value
Superfamily Kringle-like 7.14e-20
Family Fibronectin type II module 0.0000994
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017612   Gene: ENSPANG00000022398   Transcript: ENSPANT00000020332
Sequence length 616
Comment pep:known_by_projection chromosome:PapAnu2.0:10:18259885:18267532:-1 gene:ENSPANG00000022398 transcript:ENSPANT00000020332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPCEPHGAGSQTWADSKPFEGDLKWHHHNITYWIQNYSEDLPRAVIEDAFARAFALWSAV
TPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWS
LGKGVVVPTKFGNADGAACHFPFTFEGRSYSACTTDGRSDGVPWCSTTANYDTDRRFGFC
PSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDQDKLYGFCPT
RADSTVIGGNSAGELCVFPFTFLGKEYSTCTSEGRRDGYLWCATTSNFDRDKKWGFCPDQ
GYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEEPPLHKDDVNGIQYLYGSRPEPEP
RPPTTTTPQPTAPPTVCPTGPPTVRPSDRPTAGPTGPPSAGPTGPPTAGPSTTTPVPLNP
VDDACNVNIFDAITEIGNQLYLFKDGRYWRFSERRGSRLQGPFLIADTWPALPRKLDSAF
EEPLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRRGAGKMLLFSGRR
FWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYQEKAYFCQDRFYWRVSSQSEVNQV
DQVGYVTYDILQCPED
Download sequence
Identical sequences ENSPANP00000017612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]