SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017613 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017613
Domain Number 1 Region: 512-705
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.35e-58
Family Hemopexin-like domain 0.00000000568
Further Details:      
 
Domain Number 2 Region: 89-214,388-443
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.34e-32
Family Matrix metalloproteases, catalytic domain 0.00000059
Further Details:      
 
Domain Number 3 Region: 334-389
Classification Level Classification E-value
Superfamily Kringle-like 1.03e-21
Family Fibronectin type II module 0.00011
Further Details:      
 
Domain Number 4 Region: 273-330
Classification Level Classification E-value
Superfamily Kringle-like 3.71e-21
Family Fibronectin type II module 0.000075
Further Details:      
 
Domain Number 5 Region: 217-272
Classification Level Classification E-value
Superfamily Kringle-like 8.28e-20
Family Fibronectin type II module 0.0000923
Further Details:      
 
Domain Number 6 Region: 30-104
Classification Level Classification E-value
Superfamily PGBD-like 1.73e-18
Family MMP N-terminal domain 0.0000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017613   Gene: ENSPANG00000022398   Transcript: ENSPANT00000020331
Sequence length 706
Comment pep:known_by_projection chromosome:PapAnu2.0:10:18259885:18267532:-1 gene:ENSPANG00000022398 transcript:ENSPANT00000020331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWQPLVLALLVLGCCCAAPRQRRSTLVLFPGDLKTNLTDRQLAEDYLYRYGYTRVAEM
HGDSKSLGPALLLLQKQLSLPQTGELDSATLKAMRTPRCGVPDLGRFQFEGDLKWHHHNI
TYWIQNYSEDLPRAVIEDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPF
DGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTKFGNADGAACHFPFTFEGRSY
SACTTDGRSDGVPWCSTTANYDTDRRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSA
CTTDGRSDGYRWCATTANYDQDKLYGFCPTRADSTVIGGNSAGELCVFPFTFLGKEYSTC
TSEGRRDGYLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYP
MYRFTEEPPLHKDDVNGIQYLYGSRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVRPSDRP
TAGPTGPPSAGPTGPPTAGPSTTTPVPLNPVDDACNVNIFDAITEIGNQLYLFKDGRYWR
FSERRGSRLQGPFLIADTWPALPRKLDSAFEEPLSKKLFFFSGRQVWVYTGASVLGPRRL
DKLGLGADVAQVTGALRRGAGKMLLFSGRRFWRFDVKAQMVDPRSASEVDRMFPGVPLDT
HDVFQYQEKAYFCQDRFYWRVSSQSEVNQVDQVGYVTYDILQCPED
Download sequence
Identical sequences ENSPANP00000017613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]