SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017743 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017743
Domain Number 1 Region: 12-116
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 6.41e-33
Family Nucleoplasmin-like core domain 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017743   Gene: ENSPANG00000016617   Transcript: ENSPANT00000011804
Sequence length 237
Comment pep:novel chromosome:PapAnu2.0:10:25207862:25208685:1 gene:ENSPANG00000016617 transcript:ENSPANT00000011804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSMDMDVSPLRPQNYLLGCELKANKDHHFKVDIHENEHQLSLRTVSSGAGAKDELHIV
EAKANVEGSPIKVILATLKMSVQPMISLSGFEIIPPVILQLKCGSEPVQISGQHLVAVEE
DAEPEDEEEDVKFFSISGRRSAPGGGSKVPEKKVKPAAETEGKAPVKKSIQDTPAQKSNQ
NGKDSIPSTPSSAENTEAKMRASIEKGGSLPKVEAKFINYVKNCFRMTDQEALQDLW
Download sequence
Identical sequences ENSPANP00000017743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]