SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017831 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017831
Domain Number 1 Region: 929-1265
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 4.58e-116
Family Methionine synthase SAM-binding domain 0.0000000595
Further Details:      
 
Domain Number 2 Region: 23-414
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.07e-110
Family Homocysteine S-methyltransferase 0.0000116
Further Details:      
 
Domain Number 3 Region: 371-645
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 2.22e-85
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00054
Further Details:      
 
Domain Number 4 Region: 769-922
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 7.59e-41
Family Cobalamin (vitamin B12)-binding domain 0.00000302
Further Details:      
 
Domain Number 5 Region: 665-754
Classification Level Classification E-value
Superfamily Methionine synthase domain 8.76e-27
Family Methionine synthase domain 0.0000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017831   Gene: ENSPANG00000009146   Transcript: ENSPANT00000014069
Sequence length 1266
Comment pep:known_by_projection chromosome:PapAnu2.0:1:212204136:212306786:-1 gene:ENSPANG00000009146 transcript:ENSPANT00000014069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPALQDLSQPAGLKKTPRDEIDAILRKRIMLLDGGMGTMIQRQKLNEEHFRGQEFKDHA
RPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNKC
SAGVARKAAEEITLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELIEAYQEQA
KGLLDGGVDILLIETIFDTANAKAAVFALQNLFEEKYAPRPIFISGTIVDKSGRTLSGQT
GEAFVISLSHAEPLCIGLNCALGAAEMRPFIEMIGKCTTAYVLCYPNAGLPNTFGDYDET
PSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATVFEGHMLLSEL
NPFRIGQYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALGVARVQVEMGAQVLDINMDDG
MLDGPSAMARFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDD
FLEKARKIKKFGAAMVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNI
LTIGTGMEEHNLYAINFIHATKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLY
HAIKSGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQTQGTGGKKV
IQTDEWRNGPVEERLEYALVKGIEKHIIEDTEEARLNQERYPRPLNIIEGPLMNGMKIVG
DLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTIEEEDPYQGTIVLATV
KGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKAVDIIGLSGLITPSLDE
MIFVAKEMERLAIKIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDE
NLKDEYFEEIMEEYEDIRQDHYESLKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQ
VFEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGEEPKKVYDDAQNMLNT
LINQKKLQARGVVGFWPAQSIQDDIHLYTESAVPQAAEPIATFYGLRQQAEKDSASTEPY
YCLSDFIAPLHSGIRDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAE
ELHERVRRELWAYCGSEQLDVADLRRLRYEGIRPAPGYPSQPDHTEKLTMWKLADIEQST
GIRLTESLAMAPASAVSGLYFSNLKSKYFAVGKISRDQVEDYALRKNMSVAEVEKWLGPI
LGYDTD
Download sequence
Identical sequences ENSPANP00000017831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]