SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017849 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017849
Domain Number 1 Region: 422-622
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-62
Family Kelch motif 0.0000107
Further Details:      
 
Domain Number 2 Region: 155-269
Classification Level Classification E-value
Superfamily POZ domain 1.41e-32
Family BTB/POZ domain 0.0014
Further Details:      
 
Domain Number 3 Region: 599-707
Classification Level Classification E-value
Superfamily Kelch motif 4.58e-30
Family Kelch motif 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017849   Gene: ENSPANG00000003768   Transcript: ENSPANT00000008598
Sequence length 709
Comment pep:known_by_projection chromosome:PapAnu2.0:5:33771533:33835601:1 gene:ENSPANG00000003768 transcript:ENSPANT00000008598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSRKEFDVKQILKIRWRWFGHQASSPNSTVDSQQGEFWNRGQTGANGGRKFLDPCSLQ
LPLASIGYRRSSQLDFQNSPSWPMASTSEVPAFEFTAEDCGGAHWLDRPEVDDGTSEEEN
ESDSSSCRTSNSSQTLSSCHTMEPCSSDEFFQALNHAEQTFKKMENYLRHKQLCDVILVA
GDRRIPAHRLVLSSVSDYFAAMFTNDVREARQEEIKMEGVEPNSLWSLIQYAYTGRLELK
EDNIECLLSTACLLQLSQVVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTM
EHFMEVIRNQEFALLPASEIAKLLASDDMNIPNEETILNALLTWVRHDLEQRRKDLSKLL
AYIRLPLLAPQFLADMENNALFRDDIECQKLIMEAMKYHLLPERRPMLQSPRTKPRKSTV
GTLFAVGGIDSTKGATSIEKYDLRTNMWTPVANMNGRRLQFGVAVLDDKLYVVGGRDGLK
TLNTVECYNPKTKTWSVMPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQAR
QWNFVATMSTPRSTVGVAVLSGKLYAVGGRDGSSCLKSVECFDPHTNKWTLCAQMSKRRG
GVGVTTWNGLLYAIGGHDAPACNMTSRLSDCVERYDPKTDMWTAVASMSISRDAVGVCLL
GDKLYAVGGYDGQAYLNTVEAYDPQTNEWTQVAPLCLGRAGACVVTVKL
Download sequence
Identical sequences A0A096NXP8
ENSPANP00000017849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]