SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018150 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018150
Domain Number 1 Region: 91-135
Classification Level Classification E-value
Superfamily LysM domain 0.0000000107
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018150   Gene: ENSPANG00000017804   Transcript: ENSPANT00000007656
Sequence length 866
Comment pep:known_by_projection chromosome:PapAnu2.0:8:101692952:101783914:1 gene:ENSPANG00000017804 transcript:ENSPANT00000007656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYLTTFTEKSGRLLRGTANRLWGFGGGGEARQVRFEDYLREPAQGDLGCGSPPHRPPAP
SSPEGPDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNK
LFSRAVVTGQVLYVPDPEYVSSVESSPSLSPISPLSPTSSEAEFDKTTNPDVHPKETTPS
STFTGIRPARVVSSTSEEEEAFTEKFLKINCKYITSGKGTVSGVLLVTPNNIMFDPHKTD
PLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIEIDQLSGRDFCHSKKMTGSN
TEEIDSRIRDAGNDSASTAPRSTEESLSEDVFTESELSPIREELVSSDELQQDKSSGASS
ESVQTVNQTEVESPTVKSESTGTPGHSRSDTEHSTNEVGTLCHKTDLNNLEMAIKEGDQI
ADNFQGISGPKEDSTNIKGNSDQDFFLHENSLHQEGSKKENMPCGETAEFKQKQTVKGKQ
GKEQNRDSETEVEELRKLWKTHTMQQTKQQRENIQQVSQKEAKHKITSADGHIESSALLK
EKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFI
QWSPEIYAEDTGEYAREPGFIVVKKIEESETIEDSSNQAAAREWEVVSVAEYHRRIDALN
TEELRTLCRRLQITTREDINSKQVAPVKADLESESFRPNLSDPSELLLPDQIEKLTKHLP
PRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDG
FYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHS
CKTFGNRTLSKKEDFFIQDIEIWAFE
Download sequence
Identical sequences ENSPANP00000018150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]