SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018177 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018177
Domain Number 1 Region: 161-379
Classification Level Classification E-value
Superfamily DNA-glycosylase 3.3e-67
Family Mismatch glycosylase 0.0000282
Further Details:      
 
Domain Number 2 Region: 427-567
Classification Level Classification E-value
Superfamily Nudix 2.33e-29
Family MutY C-terminal domain-like 0.000000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018177   Gene: ENSPANG00000014791   Transcript: ENSPANT00000019317
Sequence length 618
Comment pep:known_by_projection chromosome:PapAnu2.0:1:47566200:47580114:-1 gene:ENSPANG00000014791 transcript:ENSPANT00000019317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TYWFSKLFLSPSPLSSSLTVSTATKLAVFMASRRDGHISLKLLLCTSTTGTRTTSSSPDV
VLLLTPPGGFSHKPLYPTCSAAMTPLVSRLSRLWAIMRKPRAAVGSGHRRQAASQEGRQK
HAKSNSQAKPSACDGLARQPEEVVLQASVSPYHLFRDVAEVTAFRRSLLSWYDQEKRDLP
WRRRAEDEVDPDRRAYAVWVSEVMLQQTQVATVINYYTGWMQKWPTLQDLASASLEEVNQ
LWAGLGYYSRGRRLQEGARKVVEELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQAT
GVVDGNVARVLCRVQAIGADPSSTLVSQRLWGLAQQLVDPARPGDFNQAAMELGATVCTP
QRPLCSQCPVQSLCRARQRVEREQLLASRSLSGNPDVEECALNTGQCQLCLPASEPWDQT
LGVVNFPRKASRKPPREESSATCVLEQPGALGGAQILLVQRPNSGLLAGLWEFPSVTWEP
SEQLQRKALLQELQRWAGPLPATRLRHLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPA
GARWLTQEEFHTAAVSTAMKKVFRVYQGQQPGTCKGSKRSQVSSPCSRKKPCMGQQVLDN
FFRPHISTDASNLNSAAQ
Download sequence
Identical sequences ENSPANP00000018177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]