SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018350 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018350
Domain Number 1 Region: 280-382
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000562
Further Details:      
 
Domain Number 2 Region: 387-488
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 3 Region: 167-270
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 4 Region: 498-543
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 
Domain Number 5 Region: 99-170
Classification Level Classification E-value
Superfamily Kringle-like 1.67e-16
Family Kringle modules 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018350   Gene: ENSPANG00000018164   Transcript: ENSPANT00000005174
Sequence length 544
Comment pep:known_by_projection chromosome:PapAnu2.0:5:109405906:109456503:-1 gene:ENSPANG00000018164 transcript:ENSPANT00000005174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLAGFVLALVLGALPEVVGFDSVLNDSLHHRHRHSPPPGPQYPYYLPTHQRPPRTRPPP
PLPRFPRPPRALPAQRPHALQAGHTPRPHPWGCPAGEPWVSVTDFGAPCLRWAEVPPFLE
RSPPANWAQLRGQRHNFCRSPDGTGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGKNEFE
GTVEVYASGAWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPVYWSNVRCR
GDEENILLCEKDIWQGGVCPQKMAAAVTCSFSRGPAFPIIRLVGGSSVHEGRVELYHAGQ
WGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCP
KSSWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELN
TYVVCRQLGFKYGKQASANHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGQHDCSHRED
VSIACYPGSEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQ
LGYK
Download sequence
Identical sequences ENSPANP00000018350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]