SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018397 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018397
Domain Number 1 Region: 298-560
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.06e-86
Family Eukaryotic proteases 0.000000000632
Further Details:      
 
Domain Number 2 Region: 105-210
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-33
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 3 Region: 213-301
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-29
Family Kringle modules 0.00000951
Further Details:      
 
Domain Number 4 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 2.82e-20
Family Fibronectin type I module 0.0000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018397   Gene: ENSPANG00000006697   Transcript: ENSPANT00000009353
Sequence length 562
Comment pep:known_by_projection chromosome:PapAnu2.0:8:40447810:40464991:-1 gene:ENSPANG00000006697 transcript:ENSPANT00000009353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAMKRGLCCVLLLCGAVFASPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKHCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGLAYRGTHSLTASGASCLPWN
SMILIGKVYTAQNPNAQALGLGKHNYCRESDGDVKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISFCWILSAAHCFQ
ERFPPHHLTVYLGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSHCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEASSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIQDNMQP
Download sequence
Identical sequences ENSPANP00000018397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]