SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018441 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018441
Domain Number 1 Region: 314-593
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-60
Family Kelch motif 0.00013
Further Details:      
 
Domain Number 2 Region: 17-128
Classification Level Classification E-value
Superfamily POZ domain 8.05e-31
Family BTB/POZ domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018441   Gene: ENSPANG00000014471   Transcript: ENSPANT00000006259
Sequence length 606
Comment pep:known_by_projection chromosome:PapAnu2.0:12:31415356:31433413:1 gene:ENSPANG00000014471 transcript:ENSPANT00000006259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQRELAEELRLYQSTLLQDGLKDLLDEKKFIDCTLKAGDKSLPCHRLILSACSPYFRE
YFLSEIDEAKKKEVVLDNVDPAILDLIIKYLYSASIDLNDGNVQDIFALASRFQIPSVFT
VCVSYLQKRLAPGNCLAILRLGLLLDCPRLAISAREFVSDRFVQICKEEDFMQLSPQELI
SVISNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDD
IIKSNPDLQKKIKVLKDAFAGKLPEPSKNVQKTGAGEVNGDVGDEDLLPGYLNDIPRHGM
FVKDLILLVNDTAAVAYDPTENECYLTALAEQIPRNHSSIVTQQNQIYVVGGLYVDEENK
DQPLQSYFFQLDSIASEWVGLPPLPSARCLFGLGEVDDKIYVVAGKDLQTEASLDSVLCY
DPVAAKWNEVKKLPIKVYGHNVISHKGMIYCLGGKTDDKKCTNRVFIFNPKKGDWKDLAP
MKTPRSMFGVAVHKGKIVIAGGVTEDGLSASVEAFDLTTNKWDVMTEFPQERSSISLVSL
AGSLYAIGGFAMIQLESKEFAPTEVNDIWKYEDDKKEWAGMLKEIRYASGASCLATRLNL
FKLSKL
Download sequence
Identical sequences A0A096NZC0 A0A2K5M6E3 A0A2K6ADF5
XP_011843539.1.47321 XP_011902311.1.92194 XP_011902312.1.92194 ENSPANP00000018441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]