SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018445 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018445
Domain Number 1 Region: 436-1009
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.35e-140
Family alpha-mannosidase, C-terminal domain 0.0000457
Further Details:      
 
Domain Number 2 Region: 25-353
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.6e-101
Family alpha-mannosidase 0.0000092
Further Details:      
 
Domain Number 3 Region: 358-458
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.18e-27
Family alpha-mannosidase, domain 2 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018445   Gene: ENSPANG00000016783   Transcript: ENSPANT00000010503
Sequence length 1011
Comment pep:known_by_projection chromosome:PapAnu2.0:5:2159756:2208112:-1 gene:ENSPANG00000016783 transcript:ENSPANT00000010503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQLRWLPLLALLLLLRPPGVQSADPIQAFVVPHSHMDVGWVYTVQESMQAYAANVYTSV
VEELARGQQRRFIAVEQEFFRLWWDGVASEQQKHQVRQLLEEGRLEFVIGGQVMHDEAVT
HLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLFALAGFNAHLGSRIDYDL
KAAMQSPGLQGLQFVWRGSPSLSEQQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNGVAVF
PKPPPDGVYPNMSEPVTPANINLYAEALVANVKQRAAWFQTPHVLWPWGCDKQFFNASVQ
FANMDPLLDHINSHAAELGVSVQYATLGDYFRALHALNVTWHVRDHHDFLPYSTEPFQAW
TGFYTSRSTLKGLARRASALLYAGESMFTRYMWPAPHGHLDPTWALQQLQQLRWAVSEVQ
HHDAITGTESPKVRDMYVTHLASGMLGVRKLMASIVLDKLQPQAPTAASSGAGPAGHFTS
VYNPLAWTVTTVVTLTVGFPGVRVTDEAGHPVPSQIQNSTETPSAYDLLILTTIPGLSYR
HYSIRPTAGAQEGTQEPAATVASMLQFGRRRRRRTSPAGRRLVPVANDCYIVLLDQDTNL
MHSIWERQSNRTVRVTQEFLEYHVNGDVKQGPISDNYLFTPGKAAVPAWEAVGMEIMAGQ
LVTEIRQYFYRNMTAQNYTYAIRSRLTHMPQGHDGELLCHRIEQEYRAGPLELNREAVLR
TSTSLNNQQVIYSDNNGYQMQRRPYLSYVNNSIARNYYPMVQSAFMEDDESRLVLLSERA
HGISSQENGQVEVMLHRRLWNNFDWDLGYNLTLNDTSVVHPVLWLLLGSWSLTAALRQRS
AVALQHRPVVLFGDLAGTAPKLPGPQQQEAVTLPPNLHLQILSIPGWRYSSNHTEHAQSL
RKGHRGEAQADLRRVLLRLHHLYEVGEDPVLSQPVTVNLEAVLQALGSVVAVEERSLTGT
WDVGMLHRWSWRTGPGRHRGDTTFPSRPPGGPIITVHPKEIRTFFVHFQQQ
Download sequence
Identical sequences ENSPANP00000018445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]