SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018638 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018638
Domain Number 1 Region: 18-182
Classification Level Classification E-value
Superfamily EF-hand 5.87e-47
Family Penta-EF-hand proteins 0.0000000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018638   Gene: ENSPANG00000010213   Transcript: ENSPANT00000024423
Sequence length 183
Comment pep:known_by_projection chromosome:PapAnu2.0:3:113795685:113818296:1 gene:ENSPANG00000010213 transcript:ENSPANT00000024423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETC
RLMVSMLDRDMSGKMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFR
LSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCV
MSV
Download sequence
Identical sequences A0A0D9RJ41 A0A1D5R0N1 A0A2I3LF62 A0A2K5LWP3 A0A2K5TVD2 A0A2K6BJ91
ENSPANP00000018638 XP_005550355.1.63531 XP_007980456.1.81039 XP_011729006.1.29376 XP_011936839.1.92194 XP_014989551.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]