SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018640 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018640
Domain Number 1 Region: 170-318
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.14e-42
Family Mannose 6-phosphate receptor domain 0.000000164
Further Details:      
 
Domain Number 2 Region: 322-466
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.23e-41
Family Mannose 6-phosphate receptor domain 0.000000637
Further Details:      
 
Domain Number 3 Region: 1518-1649
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.62e-36
Family Mannose 6-phosphate receptor domain 0.000000119
Further Details:      
 
Domain Number 4 Region: 1368-1509
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.79e-36
Family Mannose 6-phosphate receptor domain 0.00062
Further Details:      
 
Domain Number 5 Region: 759-924
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.75e-35
Family Mannose 6-phosphate receptor domain 0.0012
Further Details:      
 
Domain Number 6 Region: 626-762
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-34
Family Mannose 6-phosphate receptor domain 0.00048
Further Details:      
 
Domain Number 7 Region: 479-617
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.31e-31
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 8 Region: 1225-1365
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.66e-31
Family Mannose 6-phosphate receptor domain 0.00015
Further Details:      
 
Domain Number 9 Region: 45-166
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-30
Family Mannose 6-phosphate receptor domain 0.000000762
Further Details:      
 
Domain Number 10 Region: 1654-1799
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-30
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 11 Region: 1068-1221
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.72e-30
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 12 Region: 2135-2282
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.62e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 13 Region: 1989-2128
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.23e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 14 Region: 1806-1899,1948-1991
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.59e-21
Family Mannose 6-phosphate receptor domain 0.0029
Further Details:      
 
Domain Number 15 Region: 1898-1947
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-16
Family Fibronectin type II module 0.0012
Further Details:      
 
Domain Number 16 Region: 953-1083
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000000000017
Family Mannose 6-phosphate receptor domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018640   Gene: ENSPANG00000018547   Transcript: ENSPANT00000008555
Sequence length 2494
Comment pep:known_by_projection chromosome:PapAnu2.0:4:155274053:155406466:1 gene:ENSPANG00000018547 transcript:ENSPANT00000008555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAAGRSSHLGPAPAGRPQRSLLLLQLLLLVAAPGATQAEAAPFPELCSYTWEAVDTKN
NVLYKINICGSVDVVQCGPSSAVCMHDLKTHTYHSIGDSVLRSATRSLLEFNTTVSCDRP
GTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDIFKAKKEVPCYVFDEE
LRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGD
QAFNVGQPQEGLKLVRKDRLVLSYVREEAGELDFCDGHSPAVTITFVCPSERREGTIPKL
TAKSNCRYEVEWITEYACHRDYLESKTCSLSGEQQDVSIDLTPLAQSGGSPYSSDGKEYL
FYLNVCEETETQFCNKKQAAVCQVKKNNTSQVKAAGRYQNQTLRYSDGDLTLIYFGGDEC
SSGFQRMSVINFECNKTAGNDGKGSPVFTGEVDCTYFFTWDTKYACVKEKEDLLCGAVDG
KKRYDLSALVRHAEPEQNWEAVDGSQTETEKKHFFINICHRVLQADKARGCPEDAAVCAV
DKNGSKNLGKFISSPTKEKGNIQLSYSDGDDCGHGKKIRTNITLVCKPGDLESAPVLRTS
GEGGCFYEFEWHTAAACVLSKTEGENCTVFDSQAGGFAEYLSPLTKKNGAYKVETKKYDF
YINVCGPVSVSPCQPDSGACQVAKSDEKTWNLGLSNAKLSYYDGMIQLNYRGGTPYNNER
HTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECVVTDPSTLEQYD
LSSLAKSEGGPGGNWYAMDNSGEHVTWRKYYINVCRPLNPVPGCNRYASACQMKYEKDQG
SFTEVVSISNLGMAKTGPTIEDSGSLLLEYVNGSTCTTSDGRQTTYTTRIHLVCSRGRLN
SHPIFSLNWECVVTFLWNTEAACPIQTATDTDQAVDRGRPRAKFMSLMFPLQLXQGYVFF
NIGKTFVFNVCGTMPVCGTIQGKPASGCEAETQTEDLQNLKPERAVGIEKSLQLSTEGFI
TLTYKGPVSAKGSADAFIIRFVCNDGVYPAISKFLHQDIDSGQGIRNTYFEIETALACVP
SPVDCQVTVSDPAGNEYDLSGLSMVRKPWTAVDTSVDGRKRTFYLSVCSPLPDIPGCHGS
AMGSCLVSEVNNWNLGVVQMSPQAAANGSLSIMYVNGDKCGNQRFSTRITFECAQISGSP
TFQLQDGCEYVFIWRTVEACPIVRVEGDNCEVKDPRHGNLYDLKPLGLNDTIVSAGEYTY
YFRVCGKLSSDVCPTSDKSRVVSSCQEKREPQGFHKVAGLLTQKLTYENGLLKMNFTGGD
TCHKVYQRSTAIFFYCDRSTQQPVFLKETSDCSYLFEWRTQYACPPFDVTECSFKDGTGN
SFDLSSLSRYSENWEAITATGDPEHYLINVCKSLAPHGGTEPCPPEAAACLLGSSKPVNL
GRVRDGPQWRDGVIVLKYVDGDLCPDGIRKKSTTIRFTCNENQVNSRPMFISAVEDCEYT
FAWPTATACPVQNNEHDDCQVTNPSTGHLFDLTSLSGRAGFTAAYSEKGLVYMSICGENE
NCPPGVGACFGQTRISVGKASKRLRYVDQVLQLVYKDGSPCPSKSGLTYKSVISFVCRPE
AGPTNRPMLISLDKQTCTLFFSWHTPLACEQATECSVRNGSSIVDLSPLIHRTGGYEAYD
ESEDDGSDTNPDFYINICQPLNPMHGVPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPVA
NEIYLNFESSTPCLADKHFNYTSLIAFHCKRGVSMGTPKLLRTSECDFVFEWETPVVCPD
EVRTEGCALTDEQLLYSFNLSSLSTSTFKVTRDSRTYSVGVCTAAAGPEQGGCKDGGVCL
LSGTKGASFGRLQSMKLDYRHQDEAVVLSYVNGDRCPPETDEGIPCVFPFTFNGKSYEEC
VIESRAKLWCSTTADYDRDHEWGFCRHSNSHRTSSIIFKCDEDEDIGRPQVFSEVRGCDV
TFEWKTKVVCPPKKMECKFIQKHKTYDLRLLSSLTGSWSLVHDGVSYYINLCQRIYKGPL
GCSERASICRRSTTGDVQVLGLVHTQKLDVIGDKVVVMYSRGYPCGGNKTASSVIELTCT
KTVGRPAFKRFDIDSCTYYFSWDSRAACAVKPQEVQMVNGTITNPINGKSFSLGDIYFKL
FRASGDMRTNGDNYLYEIQLSSITSSRNPACSGANICQVKPDDQHFSRKVGTSDKTKYYL
QDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVEDGIPEFSHETADCQYLFSWYTSAV
CPLGVGFDSENPGDDEQVHKGLSERSQAVGAVLSLLLVALTGCLLALLLYKKERRETVIS
KLTTCCRRSSNVSYKYSKVNKEEETDENETEWLMEEIQLPSPRQGKEGQENGHITTKSVK
ALSSLHGDDQDSEDEVLTIPEVKVHSGRGAGAESSHPVRNPQSSALQEREDDRAGLVRGE
KARKGKSRSAQQKTVSSTKLVSFHDDSDEDLLHI
Download sequence
Identical sequences ENSPANP00000018640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]