SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018659 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018659
Domain Number 1 Region: 512-755
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.79e-81
Family Eukaryotic proteases 0.0000000164
Further Details:      
 
Domain Number 2 Region: 313-416
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-38
Family Kringle modules 0.00000739
Further Details:      
 
Domain Number 3 Region: 427-509
Classification Level Classification E-value
Superfamily Kringle-like 1.09e-36
Family Kringle modules 0.00000724
Further Details:      
 
Domain Number 4 Region: 41-131
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-36
Family Kringle modules 0.0000029
Further Details:      
 
Domain Number 5 Region: 131-213
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-34
Family Kringle modules 0.00000786
Further Details:      
 
Domain Number 6 Region: 210-307
Classification Level Classification E-value
Superfamily Kringle-like 9.67e-34
Family Kringle modules 0.00000693
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018659
Domain Number - Region: 1-25
Classification Level Classification E-value
Superfamily Kringle-like 0.0556
Family Kringle modules 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018659   Gene: ENSPANG00000014232   Transcript: ENSPANT00000007374
Sequence length 756
Comment pep:known_by_projection chromosome:PapAnu2.0:4:155746060:155885220:-1 gene:ENSPANG00000014232 transcript:ENSPANT00000007374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSVRWEYCNLTQCLVTESSVLETLTVVPDPSTQASSEEAPTEQSPEVQDCYHGDGQSY
RGSFSTTVTGRTCQSWSSMTPHWHQRTTEYYPNGGLTRNYCRNPDAEIRPWCYTMDPSVR
WEYCNLTQCPEDCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWHQRTIEYYPNGGLTKN
YCRNPDAEIRPWCYTMDPRVRWEYCNLTQFSAPTENSPGVQDCYQGDGQSYRGTFSTTIT
GRTCQSWLSMTPHWHRRIPLYYPKICSGLTRNYCRNPDAEIRPWCYTMDPSVRWEYCNLT
QCPDSGHQKTLSAPPEKSPVVQDCYHGDGQSYRGTSSTTVTGRNCQSWSSMIPHWHQRTP
ENYPNAGLTRNYCRNPDSGKQPWCYTTDPCVRWEYCNLTQCSETESDVLETPTVVPVPSM
EAHSEAVQCYHGNGQSYRGTFSTTVTGRTCQSWSSMTPHQHKRTPENHPNDGLTMNYCRN
PDADTGPWCFTMDPSVRWEYCNLTRCSSSSFDCGKPQVEPKKCPGRVVGGCVAHAHSWPW
QVSLRTRFGKHFCGGTLISPEWVLTAARCLETFSRPSSYKVILGAHQEVNLESHVQEIEV
SRLFLEPTGADIALLKLSRPAIITDKVIPACLPSPNYVITAWTECYITGWGETQGTFGAG
LLKEAQLHVIENTVCNRYEFLNGRVKSTELCAGHLAGGTDSCQGDSGGPVVCFDKDKYIL
RGITSWGPGCARPNKPGVYVRVSSFVTWIEGVMRNN
Download sequence
Identical sequences ENSPANP00000018659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]